Sorting Nexin 7 antibody (Middle Region)
-
- Target See all Sorting Nexin 7 (SNX7) Antibodies
- Sorting Nexin 7 (SNX7)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Sorting Nexin 7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SNX7 antibody was raised against the middle region of SNX7
- Purification
- Affinity purified
- Immunogen
- SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND
- Top Product
- Discover our top product SNX7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNX7 Blocking Peptide, catalog no. 33R-4867, is also available for use as a blocking control in assays to test for specificity of this SNX7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Sorting Nexin 7 (SNX7)
- Alternative Name
- SNX7 (SNX7 Products)
- Synonyms
- zgc:92458 antibody, SNX7 antibody, 2510028H01Rik antibody, sorting nexin 7 antibody, sorting nexin-7 antibody, SNX7 antibody, snx7 antibody, LOC715581 antibody, LOC716015 antibody, Snx7 antibody
- Background
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.
- Molecular Weight
- 45 kDa (MW of target protein)
-