RGS11 antibody (Middle Region)

Catalog No. ABIN634383

Product Details anti-RGS11 Antibody

Target: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS11 antibody was raised against the middle region of RGS11

Purification: Affinity purified

Immunogen: RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS11 Blocking Peptide, catalog no. 33R-5382, is also available for use as a blocking control in assays to test for specificity of this RGS11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS11

Target: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Alternative Name: RGS11 (RGS11 Products)

Synonyms: RS11 antibody, C78048 antibody, XRGSIV antibody, rgs9-a antibody, regulator of G protein signaling 11 antibody, regulator of G-protein signaling 11 antibody, regulator of G-protein signaling 11 L homeolog antibody, RGS11 antibody, Rgs11 antibody, rgs11.L antibody

Background: RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling