GLMN antibody (Middle Region)
-
- Target See all GLMN Antibodies
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLMN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLMN antibody was raised against the middle region of GLMN
- Purification
- Affinity purified
- Immunogen
- GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL
- Top Product
- Discover our top product GLMN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLMN Blocking Peptide, catalog no. 33R-5102, is also available for use as a blocking control in assays to test for specificity of this GLMN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLMN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
- Alternative Name
- GLMN (GLMN Products)
- Synonyms
- FAP antibody, FAP48 antibody, FAP68 antibody, FKBPAP antibody, GLML antibody, GVM antibody, VMGLOM antibody, 9330160J16Rik antibody, AW227515 antibody, Fap48 antibody, Fap68 antibody, MGC69174 antibody, GLMN antibody, zgc:194957 antibody, glmnl antibody, zgc:101567 antibody, glomulin, FKBP associated protein antibody, glomulin, FKBP associated protein L homeolog antibody, glomulin, FKBP associated protein b antibody, glomulin, FKBP associated protein a antibody, GLMN antibody, Glmn antibody, glmn.L antibody, glmn antibody, glmnb antibody, glmna antibody
- Background
- GLMN is a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Tube Formation
-