GLMN antibody (Middle Region)

Catalog No. ABIN634391

Product Details anti-GLMN Antibody

Target: GLMN (Glomulin, FKBP Associated Protein (GLMN))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLMN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLMN antibody was raised against the middle region of GLMN

Purification: Affinity purified

Immunogen: GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLMN Blocking Peptide, catalog no. 33R-5102, is also available for use as a blocking control in assays to test for specificity of this GLMN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLMN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLMN

Target: GLMN (Glomulin, FKBP Associated Protein (GLMN))

Alternative Name: GLMN (GLMN Products)

Synonyms: FAP antibody, FAP48 antibody, FAP68 antibody, FKBPAP antibody, GLML antibody, GVM antibody, VMGLOM antibody, 9330160J16Rik antibody, AW227515 antibody, Fap48 antibody, Fap68 antibody, MGC69174 antibody, GLMN antibody, zgc:194957 antibody, glmnl antibody, zgc:101567 antibody, glomulin, FKBP associated protein antibody, glomulin, FKBP associated protein L homeolog antibody, glomulin, FKBP associated protein b antibody, glomulin, FKBP associated protein a antibody, GLMN antibody, Glmn antibody, glmn.L antibody, glmn antibody, glmnb antibody, glmna antibody

Background: GLMN is a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Tube Formation