ACOT11 antibody (Middle Region)

Catalog No. ABIN634439

Product Details anti-ACOT11 Antibody

Target: ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACOT11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACOT11 antibody was raised against the middle region of ACOT11

Purification: Affinity purified

Immunogen: ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACOT11 Blocking Peptide, catalog no. 33R-1133, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACOT11

Target: ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))

Alternative Name: ACOT11 (ACOT11 Products)

Synonyms: BFIT antibody, STARD14 antibody, THEA antibody, THEM1 antibody, 1110020M10Rik antibody, 2010309H15Rik antibody, AW060409 antibody, BFIT1 antibody, Thea antibody, Them1 antibody, mKIAA0707 antibody, acot11 antibody, zgc:113011 antibody, ACOT11 antibody, DKFZp469E1816 antibody, acyl-CoA thioesterase 11 antibody, acyl-CoA thioesterase 11a antibody, acyl-CoA thioesterase 11 L homeolog antibody, ACOT11 antibody, Acot11 antibody, acot11a antibody, acot11.L antibody, acot11 antibody

Background: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth.

Molecular Weight: 65 kDa (MW of target protein)