DIRAS1 antibody (Middle Region)
-
- Target See all DIRAS1 Antibodies
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DIRAS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DIRAS1 antibody was raised against the middle region of DIRAS1
- Purification
- Affinity purified
- Immunogen
- DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
- Top Product
- Discover our top product DIRAS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DIRAS1 Blocking Peptide, catalog no. 33R-4266, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
- Alternative Name
- DIRAS1 (DIRAS1 Products)
- Synonyms
- Di-Ras1 antibody, GBTS1 antibody, RIG antibody, Gbts1 antibody, diras1 antibody, fi18d11 antibody, wu:fi18d11 antibody, zgc:55360 antibody, si:dkey-97k23.2 antibody, rig antibody, gbts1 antibody, di-ras1 antibody, MGC146486 antibody, DIRAS family GTPase 1 antibody, DIRAS family, GTP-binding RAS-like 1 antibody, DIRAS family, GTP-binding RAS-like 1a antibody, DIRAS family, GTP-binding RAS-like 1b antibody, DIRAS family GTP binding RAS like 1 antibody, DIRAS1 antibody, Diras1 antibody, diras1a antibody, diras1b antibody, diras1 antibody
- Background
- DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-