PSMB10 antibody
-
- Target See all PSMB10 Antibodies
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMB10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG
- Top Product
- Discover our top product PSMB10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMB10 Blocking Peptide, catalog no. 33R-2068, is also available for use as a blocking control in assays to test for specificity of this PSMB10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
- Alternative Name
- PSMB10 (PSMB10 Products)
- Synonyms
- Mecl-1 antibody, Mecl1 antibody, LMP10 antibody, MECL1 antibody, beta2i antibody, proteasome (prosome, macropain) subunit, beta type 10 antibody, proteasome subunit beta 10 antibody, Psmb10 antibody, PSMB10 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-