ARF1 antibody (Middle Region)

Catalog No. ABIN634449

Product Details anti-ARF1 Antibody

Target: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARF1 antibody was raised against the middle region of ARF1

Purification: Affinity purified

Immunogen: ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARF1

Target: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Alternative Name: ARF1 (ARF1 Products)

Synonyms: wu:fb33e02 antibody, wu:fb78h01 antibody, arf2 antibody, arf-1 antibody, MGC52573 antibody, ADP-RIBOSYLATION FACTOR antibody, ADP-RIBOSYLATION FACTOR 1A antibody, ADP-ribosylation factor 1 antibody, ATARF antibody, ATARF1 antibody, ATARFA1A antibody, F28C11.12 antibody, ARF1 antibody, arf1 antibody, ADP ribosylation factor 1 antibody, ADP-ribosylation factor 1 antibody, ADP ribosylation factor 1 L homeolog antibody, ADP ribosylation factor 5 L homeolog antibody, ADP ribosylation factor 1 pseudogene antibody, adp-ribosylation factor 1 antibody, ARF1 antibody, Arf1 antibody, arf1 antibody, arf1.L antibody, arf5.L antibody, NCU08340 antibody, TRIADDRAFT_63238 antibody, PAAG_08805 antibody, LOC100280562 antibody, LOC100280918 antibody, LOC474591 antibody, CLUG_01013 antibody

Background: ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Inositol Metabolic Process