NKIRAS1 antibody (N-Term)

Catalog No. ABIN634451

Product Details anti-NKIRAS1 Antibody

Target: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKIRAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NKIRAS1 antibody was raised against the N terminal of NKIRAS1

Purification: Affinity purified

Immunogen: NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKIRAS1 Blocking Peptide, catalog no. 33R-1680, is also available for use as a blocking control in assays to test for specificity of this NKIRAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKIRAS1

Target: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Alternative Name: NKIRAS1 (NKIRAS1 Products)

Synonyms: NKIRAS1 antibody, KBRAS1 antibody, kappaB-Ras1 antibody, zgc:92823 antibody, kbras1 antibody, 2400004O09Rik antibody, NFKB inhibitor interacting Ras like 1 antibody, NFKB inhibitor interacting Ras-like 1 antibody, NFKB inhibitor interacting Ras-like 1 S homeolog antibody, NFKB inhibitor interacting Ras-like protein 1 antibody, NKIRAS1 antibody, nkiras1 antibody, nkiras1.S antibody, Nkiras1 antibody

Background: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Molecular Weight: 22 kDa (MW of target protein)