LTA4H antibody (Middle Region)

Catalog No. ABIN634453

Product Details anti-LTA4H Antibody

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LTA4H antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LTA4 H antibody was raised against the middle region of LTA4

Purification: Affinity purified

Immunogen: LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LTA4H Blocking Peptide, catalog no. 33R-6634, is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LTA4H

Target: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Alternative Name: LTA4H (LTA4H Products)

Synonyms: LTA4H antibody, zgc:85809 antibody, MGC78867 antibody, lta4h antibody, MGC69197 antibody, LOC732953 antibody, DDBDRAFT_0191291 antibody, DDBDRAFT_0216768 antibody, DDB_0191291 antibody, DDB_0216768 antibody, AmpT antibody, leukotriene A4 hydrolase antibody, leukotriene A4 hydrolase L homeolog antibody, Leukotriene A4 hydrolase antibody, LTA4H antibody, lta4h antibody, lta4h.L antibody, LOC732953 antibody, Shew185_1367 antibody, Sbal195_1406 antibody, XfasM23_0741 antibody, Sbal223_2977 antibody, lkhA antibody, Lta4h antibody

Background: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Molecular Weight: 69 kDa (MW of target protein)