ADAR antibody (N-Term)

Catalog No. ABIN634454

Product Details anti-ADAR Antibody

Target: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAR antibody was raised against the N terminal of ADAR

Purification: Affinity purified

Immunogen: ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAR Blocking Peptide, catalog no. 33R-3228, is also available for use as a blocking control in assays to test for specificity of this ADAR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAR

Target: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Alternative Name: ADAR (ADAR Products)

Synonyms: red1 antibody, drada antibody, wu:fc22a02 antibody, adar1 antibody, dsRAD antibody, dsRAD-1 antibody, ADAR antibody, ADAR1 antibody, CG12598 antibody, Dmel\\CG12598 antibody, EG:BACN35H14.1 antibody, adar antibody, adr antibody, cg12598 antibody, dADAR antibody, dAdar antibody, hypnos-2 antibody, NV18763 antibody, AGS6 antibody, DRADA antibody, DSH antibody, DSRAD antibody, G1P1 antibody, IFI-4 antibody, IFI4 antibody, K88DSRBP antibody, P136 antibody, AV242451 antibody, Adar1 antibody, mZaADAR antibody, adenosine deaminase, RNA-specific antibody, adenosine deaminase, RNA-specific S homeolog antibody, adenosine deaminase, RNA specific antibody, Adenosine deaminase acting on RNA antibody, adenosine deaminase acting on RNA antibody, double-stranded RNA-specific editase 1 antibody, adar antibody, adar.S antibody, ADAR antibody, Adar antibody, CpipJ_CPIJ011849 antibody, LOC100114127 antibody

Background: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molecular Weight: 136 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus