OAS2 antibody (Middle Region)

Catalog No. ABIN634459

Product Details anti-OAS2 Antibody

Target: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OAS2 antibody was raised against the middle region of OAS2

Purification: Affinity purified

Immunogen: OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAS2 Blocking Peptide, catalog no. 33R-1294, is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAS2

Target: OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))

Alternative Name: OAS2 (OAS2 Products)

Synonyms: Oasl11 antibody, 2'-5'-oligoadenylate synthetase 2 antibody, 2'-5' oligoadenylate synthetase 2 antibody, 2'-5'-oligoadenylate synthetase 2, 69/71kDa antibody, OAS2 antibody, Oas2 antibody

Background: OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Hepatitis C