PRKRA antibody (Middle Region)

Catalog No. ABIN634469

Product Details anti-PRKRA Antibody

Target: PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKRA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PRKRA antibody was raised against the middle region of PRKRA

Purification: Affinity purified

Immunogen: PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKRA Blocking Peptide, catalog no. 33R-8043, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKRA

Target: PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))

Alternative Name: PRKRA (PRKRA Products)

Synonyms: PRKRA antibody, AV120107 antibody, PRK antibody, Pact antibody, RAX antibody, lear antibody, DYT16 antibody, PACT antibody, im:7151758 antibody, zgc:162619 antibody, dyt16 antibody, pact antibody, prkra-a antibody, prkra-b antibody, rax antibody, rbpa antibody, protein activator of interferon induced protein kinase EIF2AK2 antibody, protein kinase, interferon inducible double stranded RNA dependent activator antibody, protein kinase, interferon-inducible double stranded RNA dependent activator antibody, protein activator of interferon induced protein kinase EIF2AK2 L homeolog antibody, PRKRA antibody, Prkra antibody, prkra antibody, prkra.L antibody

Background: PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways