PRKRA antibody (N-Term)
-
- Target See all PRKRA Antibodies
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKRA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKRA antibody was raised against the N terminal of PRKRA
- Purification
- Affinity purified
- Immunogen
- PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
- Top Product
- Discover our top product PRKRA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKRA Blocking Peptide, catalog no. 33R-6483, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
- Alternative Name
- PRKRA (PRKRA Products)
- Synonyms
- PRKRA antibody, AV120107 antibody, PRK antibody, Pact antibody, RAX antibody, lear antibody, DYT16 antibody, PACT antibody, im:7151758 antibody, zgc:162619 antibody, dyt16 antibody, pact antibody, prkra-a antibody, prkra-b antibody, rax antibody, rbpa antibody, protein activator of interferon induced protein kinase EIF2AK2 antibody, protein kinase, interferon inducible double stranded RNA dependent activator antibody, protein kinase, interferon-inducible double stranded RNA dependent activator antibody, protein activator of interferon induced protein kinase EIF2AK2 L homeolog antibody, PRKRA antibody, Prkra antibody, prkra antibody, prkra.L antibody
- Background
- PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Regulatory RNA Pathways
-