BPIFA1 antibody (Middle Region)

Catalog No. ABIN634486

Product Details anti-BPIFA1 Antibody

Target: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BPIFA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLUNC antibody was raised against the middle region of PLUNC

Purification: Affinity purified

Immunogen: PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLUNC Blocking Peptide, catalog no. 33R-3412, is also available for use as a blocking control in assays to test for specificity of this PLUNC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLUNC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BPIFA1

Target: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Alternative Name: PLUNC (BPIFA1 Products)

Synonyms: LUNX antibody, NASG antibody, PLUNC antibody, SPLUNC1 antibody, SPURT antibody, bA49G10.5 antibody, Plunc antibody, BPI fold containing family A member 1 antibody, BPI fold containing family A, member 1 antibody, BPIFA1 antibody, Bpifa1 antibody

Background: PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.

Molecular Weight: 28 kDa (MW of target protein)