Perforin 1 antibody

Catalog No. ABIN634500

Product Details anti-Perforin 1 Antibody

Target: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Perforin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Perforin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Perforin 1 Blocking Peptide, catalog no. 33R-8899, is also available for use as a blocking control in assays to test for specificity of this Perforin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Perforin 1

Target: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Alternative Name: Perforin 1 (PRF1 Products)

Synonyms: FLH2 antibody, HPLH2 antibody, P1 antibody, PFN1 antibody, PFP antibody, PRF1 antibody, Pfn antibody, Pfp antibody, Prf-1 antibody, Cyta antibody, RATCYTA antibody, LOC443187 antibody, perforin antibody, prf1 antibody, cytolysin antibody, perforin-1 antibody, perforin-1-like antibody, perforin 1 antibody, perforin 1 (pore forming protein) antibody, perforin antibody, perforin 1 L homeolog antibody, PRF1 antibody, Prf1 antibody, LOC443187 antibody, prf1 antibody, prf1.L antibody

Background: PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: Apoptosis, Caspase Cascade in Apoptosis