DFFB antibody
-
- Target See all DFFB Antibodies
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DFFB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
- Top Product
- Discover our top product DFFB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DFFB Blocking Peptide, catalog no. 33R-2821, is also available for use as a blocking control in assays to test for specificity of this DFFB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DFFB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
- Alternative Name
- DFFB (DFFB Products)
- Synonyms
- CAD antibody, CPAN antibody, DFF-40 antibody, DFF2 antibody, DFF40 antibody, LOC100223514 antibody, 40kDa antibody, 5730477D02Rik antibody, Didff antibody, Cad antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antibody, DNA fragmentation factor subunit beta antibody, DNA fragmentation factor, beta polypeptide (caspase-activated DNase) antibody, DNA fragmentation factor, beta subunit antibody, CAD antibody, DFFB antibody, dffb antibody, LOC100223514 antibody, Dffb antibody
- Background
- DFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Apoptosis, Caspase Cascade in Apoptosis
-