PRKAA1 antibody (Middle Region)

Catalog No. ABIN634505

Product Details anti-PRKAA1 Antibody

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKAA1 antibody was raised against the middle region of PRKAA1

Purification: Affinity purified

Immunogen: PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKAA1 Blocking Peptide, catalog no. 33R-8915, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKAA1

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Alternative Name: PRKAA1 (PRKAA1 Products)

Synonyms: AMPK antibody, AMPKa1 antibody, cb116 antibody, im:7154392 antibody, sb:cb130 antibody, wu:fa94c10 antibody, AMPK1 antibody, AMPKalpha1 antibody, AI194361 antibody, AI450832 antibody, AL024255 antibody, C130083N04Rik antibody, ampk antibody, ampka1 antibody, PRKAA1 antibody, protein kinase AMP-activated catalytic subunit alpha 1 antibody, protein kinase, AMP-activated, alpha 1 catalytic subunit antibody, protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog antibody, PRKAA1 antibody, prkaa1 antibody, Prkaa1 antibody, prkaa1.L antibody

Background: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK).

Molecular Weight: 63 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect