NPY1R antibody (Middle Region)

Catalog No. ABIN634513

Product Details anti-NPY1R Antibody

Target: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPY1R antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NPY1 R antibody was raised against the middle region of NPY1

Purification: Affinity purified

Immunogen: NPY1 R antibody was raised using the middle region of NPY1 corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NPY1R Blocking Peptide, catalog no. 33R-9008, is also available for use as a blocking control in assays to test for specificity of this NPY1R antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPY0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NPY1R

Target: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Alternative Name: NPY1R (NPY1R Products)

Synonyms: NPY1-R antibody, NPYR antibody, NPY-1 antibody, NPY1R antibody, si:dkey-253i9.3 antibody, Npyr antibody, Y1-R antibody, npy1r-A antibody, npyr antibody, neuropeptide Y receptor Y1 antibody, neuropeptide Y receptor Y1 S homeolog antibody, NPY1R antibody, Npy1r antibody, npy1r antibody, npy1r.S antibody

Background: Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Feeding Behaviour