KLRA1 antibody (N-Term)

Catalog No. ABIN634535

Product Details anti-KLRA1 Antibody

Target: KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLRA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLRA1 antibody was raised against the N terminal of KLRA1

Purification: Affinity purified

Immunogen: KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLRA1 Blocking Peptide, catalog no. 33R-6660, is also available for use as a blocking control in assays to test for specificity of this KLRA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLRA1

Target: KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))

Alternative Name: KLRA1 (KLRA1 Products)

Synonyms: Klra2 antibody, Ly49i8 antibody, A1 antibody, Klra22 antibody, Ly49a antibody, Ly49o<129> antibody, Ly49v antibody, LY49 antibody, KLRA1 antibody, Ly49 antibody, killer cell lectin-like receptor, subfamily A, member 1 antibody, killer cell lectin-like receptor subfamily A, member 1 antibody, Klra1 antibody, KLRA1 antibody, LY49 antibody

Background: Ly-49 Receptors or killer cell lectin-like receptor subfamily A (KLRA), member 1, are a class of natural killer cell receptor. Ly-49 proteins are a diverse set of C-type lectins that are expressed on NK cells in some mammals, including rodents but not humans. Their primary function is to bind host MHC class I as a mechanism of self/health recognition. Upon binding ligands, most Ly-49 receptors will deliver an inhibitory signal, preventing killing of the target cell.

Molecular Weight: 25 kDa (MW of target protein)