C1QB antibody (Middle Region)

Catalog No. ABIN634563

Product Details anti-C1QB Antibody

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1QB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 QB antibody was raised against the middle region of C1 B

Purification: Affinity purified

Immunogen: C1 QB antibody was raised using the middle region of C1 B corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1QB Blocking Peptide, catalog no. 33R-7122, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1QB

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Alternative Name: C1QB (C1QB Products)

Synonyms: complement C1q B chain antibody, complement component 1, q subcomponent, beta polypeptide antibody, C1QB antibody, C1qb antibody

Background: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Complement System