CXCL16 antibody

Catalog No. ABIN634580

Product Details anti-CXCL16 Antibody

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXCL16 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXCL16 Blocking Peptide, catalog no. 33R-8984, is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXCL16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXCL16

Target: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Alternative Name: CXCL16 (CXCL16 Products)

Synonyms: CXCL16 antibody, 0910001K24Rik antibody, AV290116 antibody, BB024863 antibody, CXCL16v1 antibody, CXCL16v2 antibody, SR-PSOX antibody, Zmynd15 antibody, b2b498Clo antibody, CXCLG16 antibody, SRPSOX antibody, C-X-C motif chemokine ligand 16 antibody, chemokine (C-X-C motif) ligand 16 antibody, CXCL16 antibody, Cxcl16 antibody

Background: CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.

Molecular Weight: 29 kDa (MW of target protein)