ATG5 antibody

Catalog No. ABIN634588

Product Details anti-ATG5 Antibody

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATG5 Blocking Peptide, catalog no. 33R-2099, is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATG5

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Alternative Name: ATG5 (ATG5 Products)

Synonyms: APG5 antibody, APG5-LIKE antibody, APG5L antibody, ASP antibody, hAPG5 antibody, ATG5 antibody, CG1643 antibody, DmAtg5 antibody, Dmel\\CG1643 antibody, atg5 antibody, 2010107M05Rik antibody, 3110067M24Rik antibody, AW319544 antibody, Apg5l antibody, Atg5l antibody, C88337 antibody, Paddy antibody, apg5l antibody, zgc:100934 antibody, ATATG5 antibody, AUTOPHAGY 5 antibody, MKP11.20 antibody, MKP11_20 antibody, autophagy related 5 antibody, Autophagy-related 5 antibody, ATG5 autophagy related 5 homolog (S. cerevisiae) antibody, autophagy related 5 L homeolog antibody, similar to S. cerevisiae ATG5 (YPL149W) which nucleates preautophagosome formation as a conjugate with Atg12 antibody, autophagy protein Apg5 family antibody, ATG5 antibody, Atg5 antibody, atg5 antibody, atg5.L antibody, APG5 antibody

Background: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagy