RPSA/Laminin Receptor antibody (Middle Region)

Catalog No. ABIN634613

Product Details anti-RPSA/Laminin Receptor Antibody

Target: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPSA/Laminin Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPSA antibody was raised against the middle region of RPSA

Purification: Affinity purified

Immunogen: RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPSA Blocking Peptide, catalog no. 33R-9077, is also available for use as a blocking control in assays to test for specificity of this RPSA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPSA/Laminin Receptor

Target: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Alternative Name: RPSA (RPSA Products)

Synonyms: 37LRP antibody, 67LR antibody, LBP/p40 antibody, LRP/LR antibody, LamR antibody, rpsa antibody, LamR1 antibody, RPSA antibody, LAMBR antibody, LAMR1 antibody, LBP antibody, LRP antibody, NEM/1CHD4 antibody, SA antibody, lamR antibody, p40 antibody, 67kDa antibody, 67lr antibody, AL022858 antibody, Lamr antibody, Lamr1 antibody, Lamrl1 antibody, MLR antibody, P40 antibody, P40-3 antibody, P40-8 antibody, lamr1 antibody, zgc:55831 antibody, zgc:77824 antibody, DMRT1 antibody, 40S ribosomal protein SA antibody, 67kD laminin receptor antibody, ribosomal protein SA antibody, rssa antibody, rpsa antibody, RPSA antibody, Rpsa antibody, LOC100144340 antibody

Background: RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly