COL6A1 antibody (Middle Region)

Catalog No. ABIN634616

Product Details anti-COL6A1 Antibody

Target: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COL6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Collagen Type VI Alpha 1 antibody was raised against the middle region of COL6 A1

Purification: Affinity purified

Immunogen: Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6 A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Collagen Type VI Alpha 1 Blocking Peptide, catalog no. 33R-1097, is also available for use as a blocking control in assays to test for specificity of this Collagen Type VI Alpha 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COL6A1

Target: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Alternative Name: Collagen Type VI alpha 1 (COL6A1 Products)

Background: The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.

Molecular Weight: 106 kDa (MW of target protein)

Pathways: Growth Factor Binding, SARS-CoV-2 Protein Interactome