COL6A1 antibody (Middle Region)
-
- Target See all COL6A1 Antibodies
- COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COL6A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Collagen Type VI Alpha 1 antibody was raised against the middle region of COL6 A1
- Purification
- Affinity purified
- Immunogen
- Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6 A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
- Top Product
- Discover our top product COL6A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Collagen Type VI Alpha 1 Blocking Peptide, catalog no. 33R-1097, is also available for use as a blocking control in assays to test for specificity of this Collagen Type VI Alpha 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))
- Alternative Name
- Collagen Type VI alpha 1 (COL6A1 Products)
- Background
- The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.
- Molecular Weight
- 106 kDa (MW of target protein)
- Pathways
- Growth Factor Binding, SARS-CoV-2 Protein Interactome
-