IFT140 antibody

Catalog No. ABIN634619

Product Details anti-IFT140 Antibody

Target: IFT140 (Intraflagellar Transport 140 Homolog (IFT140))

Reactivity: Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFT140 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFT140 Blocking Peptide, catalog no. 33R-9681, is also available for use as a blocking control in assays to test for specificity of this IFT140 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFT140

Target: IFT140 (Intraflagellar Transport 140 Homolog (IFT140))

Alternative Name: IFT140 (IFT140 Products)

Synonyms: zC153C20.3 antibody, si:ch211-153c20.3 antibody, gs114 antibody, wdtc2 antibody, c305c8.4 antibody, c380f5.1 antibody, AI661311 antibody, Tce5 antibody, Wdtc2 antibody, mKIAA0590 antibody, MZSDS antibody, WDTC2 antibody, c305C8.4 antibody, c380F5.1 antibody, intraflagellar transport 140 homolog (Chlamydomonas) antibody, intraflagellar transport 140 antibody, intraflagellar transport protein 140 homolog antibody, ift140 antibody, IFT140 antibody, LOC100636864 antibody, LOC100645502 antibody, Ift140 antibody

Background: IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.

Molecular Weight: 165 kDa (MW of target protein)

Pathways: Hedgehog Signaling