Periostin antibody (N-Term)

Catalog No. ABIN634639

Product Details anti-Periostin Antibody

Target: Periostin (POSTN)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Periostin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POSTN antibody was raised against the N terminal of POSTN

Purification: Affinity purified

Immunogen: POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POSTN Blocking Peptide, catalog no. 33R-7797, is also available for use as a blocking control in assays to test for specificity of this POSTN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Periostin

Target: Periostin (POSTN)

Alternative Name: POSTN (POSTN Products)

Synonyms: fa99h07 antibody, pn antibody, postn antibody, wu:fa99h07 antibody, wu:fc70f09 antibody, zgc:153873 antibody, LOC100008945 antibody, osf-2 antibody, pdlpostn antibody, periostin antibody, OSF-2 antibody, OSF2 antibody, PDLPOSTN antibody, PN antibody, RP11-412K4.1 antibody, A630052E07Rik antibody, AI747096 antibody, Osf2 antibody, PLF antibody, peri antibody, Plf antibody, periostin antibody, periostin, osteoblast specific factor b antibody, periostin, osteoblast specific factor antibody, POSTN antibody, postnb antibody, postn antibody, Postn antibody

Background: POSTN binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Molecular Weight: 93 kDa (MW of target protein)