PROS1 antibody

Catalog No. ABIN634646

Product Details anti-PROS1 Antibody

Target: PROS1 (PROS) (Protein S (PROS))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PROS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Protein S antibody was raised using a synthetic peptide corresponding to a region with amino acids MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Protein S Blocking Peptide, catalog no. 33R-5808, is also available for use as a blocking control in assays to test for specificity of this Protein S antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PROS1

Target: PROS1 (PROS) (Protein S (PROS))

Alternative Name: Protein S (PROS Products)

Synonyms: PROS antibody, PS21 antibody, PS22 antibody, PS23 antibody, PS24 antibody, PS25 antibody, PSA antibody, THPH5 antibody, THPH6 antibody, zgc:154001 antibody, AW214361 antibody, protein S antibody, protein S (alpha) antibody, PROS1 antibody, Pros1 antibody, pros1 antibody

Background: PROS1 is an anticoagulant plasma protein, it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Molecular Weight: 71 kDa (MW of target protein)