Acetylcholinesterase antibody

Catalog No. ABIN634651

Product Details anti-Acetylcholinesterase Antibody

Target: Acetylcholinesterase (AChE)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acetylcholinesterase antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AChE Blocking Peptide, catalog no. 33R-9575, is also available for use as a blocking control in assays to test for specificity of this AChE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acetylcholinesterase

Target: Acetylcholinesterase (AChE)

Alternative Name: AChE (AChE Products)

Synonyms: ACEE antibody, ARACHE antibody, N-ACHE antibody, YT antibody, Ache antibody, GB14873 antibody, zgc:92550 antibody, ACE antibody, Dsim\\GD20515 antibody, GD20515 antibody, dsim_GLEANR_4292 antibody, ache antibody, mE1a antibody, mE1b antibody, mE1c antibody, mE1c-long antibody, mE1d antibody, mE1d' antibody, mE1e antibody, arache antibody, n-ache antibody, acetylcholinesterase (Cartwright blood group) antibody, acetylcholinesterase 2 antibody, acetylcholinesterase antibody, Acetylcholine esterase antibody, acetylcholinesterase (Cartwright blood group) L homeolog antibody, collagen type I alpha 2 chain antibody, ACHE antibody, AChE-2 antibody, Ache antibody, ache antibody, Dsim\Ace antibody, ache.L antibody, COL1A2 antibody, ACE-1 antibody

Background: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development