PPP2R1A antibody

Catalog No. ABIN634652

Product Details anti-PPP2R1A Antibody

Target: PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP2R1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP2R1A Blocking Peptide, catalog no. 33R-4262, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP2R1A

Target: PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))

Alternative Name: PPP2R1A (PPP2R1A Products)

Synonyms: PP2A-Aalpha antibody, PP2AAALPHA antibody, PR65A antibody, PR65 antibody, pp2a-aalpha antibody, pp2aaalpha antibody, ppp2r1a antibody, pr65a antibody, wu:fa02h04 antibody, zgc:56296 antibody, 6330556D22Rik antibody, PP2A antibody, ppp2r1a-a antibody, ppp2r1a-b antibody, protein phosphatase 2 scaffold subunit Aalpha antibody, protein phosphatase 2 scaffold subunit A alpha antibody, protein phosphatase 2 regulatory subunit A, alpha L homeolog antibody, protein phosphatase 2 regulatory subunit A, alpha antibody, protein phosphatase 2, regulatory subunit A, beta a antibody, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform antibody, protein phosphatase 2, regulatory subunit A, alpha isoform antibody, protein phosphatase 2, regulatory subunit A, alpha antibody, protein phosphatase 2 regulatory subunit A, alpha S homeolog antibody, PPP2R1A antibody, Ppp2r1a antibody, ppp2r1a.L antibody, ppp2r1a antibody, ppp2r1ba antibody, LOC583227 antibody, ppp2r1a.S antibody

Background: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades