Connexin 43/GJA1 antibody (Middle Region)

Catalog No. ABIN634660

Product Details anti-Connexin 43/GJA1 Antibody

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Connexin 43/GJA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJA1 antibody was raised against the middle region of GJA1

Purification: Affinity purified

Immunogen: GJA1 antibody was raised using the middle region of GJA1 corresponding to a region with amino acids GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA1 Blocking Peptide, catalog no. 33R-3592, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Connexin 43/GJA1

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Alternative Name: GJA1 (GJA1 Products)

Synonyms: AVSD3 antibody, CX43 antibody, DFNB38 antibody, GJAL antibody, HLHS1 antibody, HSS antibody, ODDD antibody, Cx43 antibody, AU042049 antibody, AW546267 antibody, Cnx43 antibody, Cx43alpha1 antibody, Gja-1 antibody, Npm1 antibody, connexin43 antibody, cx43a1 antibody, gja1 antibody, zfCx43.3 antibody, connexin 43 antibody, gja1-A antibody, cx43 antibody, gjal antibody, oddd antibody, dfnb38 antibody, gap junction protein alpha 1 antibody, gap junction protein, alpha 1 antibody, connexin 43 antibody, gap junction protein alpha 1 L homeolog antibody, CONNEXIN 43 protein antibody, GJA1 antibody, Gja1 antibody, cx43 antibody, gja1.L antibody, gja1 antibody, CONNEXIN 43 antibody

Background: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: MAPK Signaling, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization