C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody

Catalog No. ABIN634662

Product Details

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: CLEC4 M antibody was raised against the n terminal of CLEC4

Purification: Affinity purified

Immunogen: CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLEC4M Blocking Peptide, catalog no. 33R-6413, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Alternative Name: CLEC4M (CLEC4M Products)

Synonyms: CD209L antibody, CD299 antibody, DC-SIGN2 antibody, DC-SIGNR antibody, DCSIGNR antibody, HP10347 antibody, L-SIGN antibody, LSIGN antibody, CD209B antibody, C-type lectin domain family 4 member M antibody, CLEC4M antibody

Background: CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.

Molecular Weight: 30 kDa (MW of target protein)