ATP2A2 antibody (C-Term)
-
- Target See all ATP2A2 Antibodies
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP2 A2 antibody was raised against the C terminal of ATP2 2
- Purification
- Affinity purified
- Immunogen
- ATP2 A2 antibody was raised using the C terminal of ATP2 2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
- Top Product
- Discover our top product ATP2A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP2A2 Blocking Peptide, catalog no. 33R-9709, is also available for use as a blocking control in assays to test for specificity of this ATP2A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
- Alternative Name
- ATP2A2 (ATP2A2 Products)
- Synonyms
- atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, ATP2A2 antibody, ATP2B antibody, DAR antibody, DD antibody, SERCA2 antibody, SERCA2A antibody, ATP2 antibody, Serca2 antibody, SercaII antibody, 9530097L16Rik antibody, D5Wsu150e antibody, SERCA2B antibody, mKIAA4195 antibody, atp2a2 antibody, zgc:55380 antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antibody, atp2a1.S antibody, ATP2A2 antibody, Atp2a2 antibody, atp2a2a antibody
- Background
- ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molecular Weight
- 115 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process
-