Cx40/GJA5 antibody (N-Term)

Catalog No. ABIN634682

Product Details anti-Cx40/GJA5 Antibody

Target: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cx40/GJA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJA5 antibody was raised against the N terminal of GJA5

Purification: Affinity purified

Immunogen: GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cx40/GJA5

Target: Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))

Alternative Name: GJA5 (GJA5 Products)

Synonyms: Cx40 antibody, 5730555N10Rik antibody, Cnx40 antibody, Gja-5 antibody, ATFB11 antibody, CX40 antibody, gap junction protein, alpha 5 antibody, gap junction protein alpha 5 antibody, Gja5 antibody, GJA5 antibody

Background: GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization