PCDHB13 antibody (Middle Region)
-
- Target See all PCDHB13 Antibodies
- PCDHB13 (Protocadherin beta 13 (PCDHB13))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCDHB13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDHB13 antibody was raised against the middle region of PCDHB13
- Purification
- Affinity purified
- Immunogen
- PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI
- Top Product
- Discover our top product PCDHB13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDHB13 Blocking Peptide, catalog no. 33R-3378, is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHB13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHB13 (Protocadherin beta 13 (PCDHB13))
- Alternative Name
- PCDHB13 (PCDHB13 Products)
- Synonyms
- PCDH-BETA13 antibody, Pcdh3 antibody, Pcdbh6 antibody, PcdhbM antibody, PCDHB13 antibody, protocadherin beta 13 antibody, protocadherin beta 12 antibody, protocadherin beta-8 antibody, PCDHB13 antibody, Pcdhb12 antibody, Pcdhb13 antibody, LOC518612 antibody
- Background
- PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.
- Molecular Weight
- 85 kDa (MW of target protein)
-