GJB1 antibody (Middle Region)
-
- Target See all GJB1 Antibodies
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GJB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJB1 antibody was raised against the middle region of GJB1
- Purification
- Affinity purified
- Immunogen
- GJB1 antibody was raised using the middle region of GJB1 corresponding to a region with amino acids RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR
- Top Product
- Discover our top product GJB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJB1 Blocking Peptide, catalog no. 33R-7802, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))
- Alternative Name
- GJB1 (GJB1 Products)
- Synonyms
- GJIC antibody, cmtx antibody, cmtx1 antibody, connexin-30 antibody, connexin32 antibody, cx30 antibody, cx32 antibody, gja1 antibody, CX32 antibody, GJB1 antibody, AI118175 antibody, Cnx32 antibody, Cx32 antibody, Gjb-1 antibody, CMTX antibody, CMTX1 antibody, gjb1-a antibody, gap junction protein beta 1 antibody, connexin 32 antibody, probable serine/threonine-protein kinase CST antibody, gap junction protein, beta 1 antibody, gap junction protein beta 1 L homeolog antibody, gjb1 antibody, CX32 antibody, LOC9303136 antibody, GJB1 antibody, Gjb1 antibody, gjb1.L antibody
- Background
- This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-