CSGALNACT1 antibody (C-Term)

Catalog No. ABIN634698

Product Details anti-CSGALNACT1 Antibody

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSGALNACT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHGN antibody was raised against the C terminal Of Chgn

Purification: Affinity purified

Immunogen: CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHGN Blocking Peptide, catalog no. 33R-1910, is also available for use as a blocking control in assays to test for specificity of this CHGN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSGALNACT1

Target: CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))

Alternative Name: CHGN (CSGALNACT1 Products)

Synonyms: CSGalNAcT-1 antibody, ChGn antibody, beta4GalNAcT antibody, CHGN antibody, 4732435N03Rik antibody, Chgn antibody, RGD1307618 antibody, chondroitin sulfate N-acetylgalactosaminyltransferase 1 antibody, CSGALNACT1 antibody, csgalnact1 antibody, Csgalnact1 antibody, LOC100517735 antibody

Background: ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process