Neuroligin 4 antibody (N-Term)
-
- Target See all Neuroligin 4 (NLGN4) Antibodies
- Neuroligin 4 (NLGN4)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Neuroligin 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NLGN4 X antibody was raised against the N terminal of NLGN4
- Purification
- Affinity purified
- Immunogen
- NLGN4 X antibody was raised using the N terminal of NLGN4 corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN
- Top Product
- Discover our top product NLGN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NLGN4X Blocking Peptide, catalog no. 33R-8532, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Neuroligin 4 (NLGN4)
- Alternative Name
- NLGN4X (NLGN4 Products)
- Synonyms
- ASPGX2 antibody, AUTSX2 antibody, HLNX antibody, HNL4X antibody, NLGN4 antibody, nlgn4 antibody, NLGN4X antibody, Nlgn4x antibody, neuroligin 4, X-linked antibody, neuroligin-4, X-linked antibody, NLGN4X antibody, nlgn4x antibody, LOC100714631 antibody
- Background
- NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.
- Molecular Weight
- 92 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Synaptic Membrane
-