ITFG1 antibody (N-Term)

Catalog No. ABIN634749

Product Details anti-ITFG1 Antibody

Target: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITFG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ITFG1 antibody was raised against the N terminal of ITFG1

Purification: Affinity purified

Immunogen: ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITFG1 Blocking Peptide, catalog no. 33R-8970, is also available for use as a blocking control in assays to test for specificity of this ITFG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITFG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITFG1

Target: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Alternative Name: ITFG1 (ITFG1 Products)

Synonyms: ITFG1 antibody, DKFZp459J0328 antibody, TIP antibody, 2310047C21Rik antibody, AI314457 antibody, Cda08 antibody, D8Wsu49e antibody, integrin alpha FG-GAP repeat containing 1 antibody, T-cell immunomodulatory protein antibody, ITFG1 antibody, itfg1 antibody, LOC100550296 antibody, Itfg1 antibody

Background: ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.

Molecular Weight: 68 kDa (MW of target protein)