FGF13 antibody (Middle Region)

Catalog No. ABIN634781

Product Details anti-FGF13 Antibody

Target: FGF13 (Fibroblast Growth Factor 13 (FGF13))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGF13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FGF13 antibody was raised against the middle region of FGF13

Purification: Affinity purified

Immunogen: FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGF13 Blocking Peptide, catalog no. 33R-9144, is also available for use as a blocking control in assays to test for specificity of this FGF13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGF13

Target: FGF13 (Fibroblast Growth Factor 13 (FGF13))

Alternative Name: FGF13 (FGF13 Products)

Synonyms: FGF13 antibody, fgf2 antibody, fhf2 antibody, fgf13 antibody, FGF-13 antibody, xFGF13 antibody, FGF2 antibody, FHF-2 antibody, FHF2 antibody, Fhf2 antibody, zgc:101784 antibody, fibroblast growth factor 13 antibody, fibroblast growth factor 13 L homeolog antibody, fibroblast growth factor 13a antibody, FGF13 antibody, fgf13 antibody, fgf13.L antibody, Fgf13 antibody, fgf13a antibody

Background: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Regulation of Cell Size