BDNF antibody (Middle Region)
-
- Target See all BDNF Antibodies
- BDNF (Brain-Derived Neurotrophic Factor (BDNF))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BDNF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BDNF antibody was raised against the middle region of BDNF
- Purification
- Affinity purified
- Immunogen
- BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
- Top Product
- Discover our top product BDNF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BDNF Blocking Peptide, catalog no. 33R-2813, is also available for use as a blocking control in assays to test for specificity of this BDNF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDNF (Brain-Derived Neurotrophic Factor (BDNF))
- Alternative Name
- BDNF (BDNF Products)
- Synonyms
- ANON2 antibody, BULN2 antibody, bdnf-A antibody, BDNF antibody, bdnf antibody, brain derived neurotrophic factor antibody, brain-derived neurotrophic factor antibody, brain-derived neurotrophic factor L homeolog antibody, brain-derived neurotrophic factor S homeolog antibody, BDNF antibody, Bdnf antibody, bdnf antibody, bdnf.L antibody, bdnf.S antibody
- Background
- BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- RTK Signaling, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity
-