GDF2 antibody (Middle Region)

Catalog No. ABIN634786

Product Details anti-GDF2 Antibody

Target: GDF2 (Growth Differentiation Factor 2 (GDF2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GDF2 antibody was raised against the middle region of GDF2

Purification: Affinity purified

Immunogen: GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDF2 Blocking Peptide, catalog no. 33R-1682, is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDF2

Target: GDF2 (Growth Differentiation Factor 2 (GDF2))

Alternative Name: GDF2 (GDF2 Products)

Synonyms: bmp9 antibody, BMP-9 antibody, BMP9 antibody, Bmp9 antibody, DSL1 antibody, growth differentiation factor 2 antibody, gdf2 antibody, GDF2 antibody, Gdf2 antibody

Background: GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis