AGT antibody
-
- Target See all AGT Antibodies
- AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
- Top Product
- Discover our top product AGT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AGT Blocking Peptide, catalog no. 33R-3985, is also available for use as a blocking control in assays to test for specificity of this AGT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGT (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT))
- Alternative Name
- AGT (AGT Products)
- Synonyms
- ANHU antibody, SERPINA8 antibody, AI265500 antibody, AngI antibody, AngII antibody, Aogen antibody, Serpina8 antibody, ANRT antibody, Ang antibody, PAT antibody, wu:fb62f06 antibody, wu:fj87b02 antibody, zgc:111892 antibody, AGT antibody, angt antibody, ANGT antibody, angiotensinogen antibody, angiotensinogen (serpin peptidase inhibitor, clade A, member 8) antibody, AGT antibody, Agt antibody, agt antibody
- Background
- AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, ACE Inhibitor Pathway, EGFR Signaling Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Regulation of Lipid Metabolism by PPARalpha, Protein targeting to Nucleus, Feeding Behaviour, Monocarboxylic Acid Catabolic Process, Dicarboxylic Acid Transport, Positive Regulation of Response to DNA Damage Stimulus, Regulation of long-term Neuronal Synaptic Plasticity
-