Cholecystokinin antibody (Middle Region)
-
- Target See all Cholecystokinin (CCK) Antibodies
- Cholecystokinin (CCK)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cholecystokinin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCK antibody was raised against the middle region of CCK
- Purification
- Affinity purified
- Immunogen
- CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
- Top Product
- Discover our top product CCK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCK Blocking Peptide, catalog no. 33R-4121, is also available for use as a blocking control in assays to test for specificity of this CCK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cholecystokinin (CCK)
- Alternative Name
- CCK (CCK Products)
- Synonyms
- CCK antibody, CCK-CH antibody, cck-a antibody, cck-b antibody, cholecystokinin antibody, cholecystokinin L homeolog antibody, CCK antibody, Cck antibody, cck antibody, cck.L antibody
- Background
- Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- TCR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades, Feeding Behaviour
-