LIF antibody

Catalog No. ABIN634803

Product Details anti-LIF Antibody

Target: LIF (Leukemia Inhibitory Factor (LIF))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIF antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LIF antibody was raised using a synthetic peptide corresponding to a region with amino acids KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIF Blocking Peptide, catalog no. 33R-4712, is also available for use as a blocking control in assays to test for specificity of this LIF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIF

Target: LIF (Leukemia Inhibitory Factor (LIF))

Alternative Name: LIF (LIF Products)

Synonyms: CDF antibody, DIA antibody, HILDA antibody, MLPLI antibody, LIF, interleukin 6 family cytokine antibody, leukemia inhibitory factor antibody, LIF antibody, Lif antibody

Background: LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Positive Regulation of Peptide Hormone Secretion, Negative Regulation of Hormone Secretion, Stem Cell Maintenance, Growth Factor Binding