ABCC9 antibody

Catalog No. ABIN634823

Product Details anti-ABCC9 Antibody

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC9

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Alternative Name: ABCC9 (ABCC9 Products)

Synonyms: SUR2B antibody, DDBDRAFT_0215814 antibody, DDBDRAFT_0216237 antibody, DDB_0215814 antibody, DDB_0216237 antibody, si:dkey-183c2.3 antibody, sur2 antibody, ABC37 antibody, ATFB12 antibody, CANTU antibody, CMD1O antibody, SUR2 antibody, SUR2A antibody, AI414027 antibody, AI449286 antibody, Sur2 antibody, ABCC9 antibody, ATP binding cassette subfamily C member 9 antibody, ATP-binding cassette sub-family C member 8 antibody, ABC transporter C family protein antibody, ATP-binding cassette sub-family C member 9 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 9 antibody, ABCC9 antibody, LOC581821 antibody, abcC9 antibody, LOC100470981 antibody, abcc9 antibody, Abcc9 antibody

Background: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.

Molecular Weight: 174 kDa (MW of target protein)