SLC39A10 antibody

Catalog No. ABIN634830

Product Details anti-SLC39A10 Antibody

Target: SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC39 A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A10

Target: SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))

Alternative Name: SLC39A10 (SLC39A10 Products)

Synonyms: LZT-Hs2 antibody, 2900042E17Rik antibody, 5430433I10 antibody, mKIAA1265 antibody, Slc39a10 antibody, Zip10 antibody, zgc:63552 antibody, DKFZp459C165 antibody, solute carrier family 39 member 10 antibody, solute carrier family 39 (zinc transporter), member 10 antibody, solute carrier family 39 (zinc transporter), member 4-like antibody, SLC39A10 antibody, Slc39a10 antibody, Slc39a4l antibody, slc39a10 antibody

Background: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.

Molecular Weight: 94 kDa (MW of target protein)