LRRC52 antibody (N-Term)

Catalog No. ABIN634893

Product Details anti-LRRC52 Antibody

Target: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC52 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC52 antibody was raised against the N terminal of LRRC52

Purification: Affinity purified

Immunogen: LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC52 Blocking Peptide, catalog no. 33R-7542, is also available for use as a blocking control in assays to test for specificity of this LRRC52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC52

Target: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Alternative Name: LRRC52 (LRRC52 Products)

Synonyms: 4930413P14Rik antibody, leucine rich repeat containing 52 antibody, LRRC52 antibody, Lrrc52 antibody

Background: The function of LRRC52 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)