CNNM4 antibody (Middle Region)

Catalog No. ABIN634896

Product Details anti-CNNM4 Antibody

Target: CNNM4 (Cyclin M4 (CNNM4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNNM4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin M4 antibody was raised against the middle region of CNNM4

Purification: Affinity purified

Immunogen: Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin M4 Blocking Peptide, catalog no. 33R-5118, is also available for use as a blocking control in assays to test for specificity of this Cyclin M4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNNM4

Target: CNNM4 (Cyclin M4 (CNNM4))

Alternative Name: Cyclin M4 (CNNM4 Products)

Synonyms: DKFZp468E0110 antibody, ACDP4 antibody, 5430430O18Rik antibody, Acdp4 antibody, cyclin and CBS domain divalent metal cation transport mediator 4 antibody, cyclin M4 antibody, CNNM4 antibody, CpipJ_CPIJ006743 antibody, cnnm4 antibody, Cnnm4 antibody

Background: CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.

Molecular Weight: 86 kDa (MW of target protein)