SLC2A9 antibody (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 9)

Details for Product anti-SLC2A9 Antibody No. ABIN634903
Antigen
Reactivity
Human
40
9
7
2
2
1
1
1
Host
Rabbit
42
1
Clonality
Polyclonal
Conjugate
This SLC2A9 antibody is un-conjugated
3
3
2
2
2
2
Application
Western Blotting (WB)
40
23
4
2
1
1
1
Options
Immunogen GLUT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Purification Affinity purified
Antigen
Alternative Name GLUT9 (SLC2A9 Antibody Abstract)
Background SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.
Molecular Weight 56 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GLUT9 Blocking Peptide, catalog no. 33R-9899, is also available for use as a blocking control in assays to test for specificity of this GLUT9 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 9 (SLC2A9) antibody (ABIN634903) GLUT9 antibody used at 1 ug/ml to detect target protein.