LFNG antibody (N-Term)

Catalog No. ABIN634905

Product Details anti-LFNG Antibody

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LFNG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LFNG antibody was raised against the N terminal of LFNG

Purification: Affinity purified

Immunogen: LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LFNG

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Alternative Name: LFNG (LFNG Products)

Synonyms: SCDO3 antibody, AW061165 antibody, id:ibd2614 antibody, id:ibd5029 antibody, id:ibd5138 antibody, l-fng antibody, wu:fc69h02 antibody, wu:fi34c01 antibody, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase antibody, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase S homeolog antibody, LFNG antibody, Lfng antibody, lfng.S antibody, lfng antibody

Background: LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Notch Signaling